Shop / Immune / LL-37 · 4mg
RUO
LL-37 · 4mg
CMPDX-LL37-4 · 4493.3 g/mol
37-residue human cathelicidin-derived antimicrobial peptide. Reference compound for antimicrobial-peptide and innate-immunity research models. Lyophilized peptide. For laboratory research use only.
| Strength | 4 mg |
| Vial | 3 mL vial |
| Purity | 99.4% |
| Sequence | [LL-37, 37 aa] |
| Storage | −20°C lyophilized |
| Form | Lyophilized peptide |
| SKU | CMPDX-LL37-4 |
Pricing locked
Pricing for verified researchers. Sign in to view this product's price and add to cart.
For Research Use Only. This product has not been evaluated by the FDA. It is not intended to diagnose, treat, cure, or prevent any disease, and is not for human or veterinary use. By purchasing you accept the Terms and Strict Liability Waiver.